Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
Superfamily c.10.2: L domain-like [52058] (9 families) less regular structure consisting of variable repeats |
Family c.10.2.0: automated matches [191489] (1 protein) not a true family |
Protein automated matches [190787] (14 species) not a true protein |
Species Chaetomium thermophilum [TaxId:759272] [274975] (1 PDB entry) |
Domain d4wp6a_: 4wp6 A: [274976] automated match to d1fo1b_ |
PDB Entry: 4wp6 (more details), 1.7 Å
SCOPe Domain Sequences for d4wp6a_:
Sequence, based on SEQRES records: (download)
>d4wp6a_ c.10.2.0 (A:) automated matches {Chaetomium thermophilum [TaxId: 759272]} tkqkltsclarrynaeqklldlsalgtdetlsslgsfnnqslaeksfkalmhlvsneykd peqkneaiqavslarndildvgqvyslavtlprlrrldlsgnnlenlskiskwqqefrfl eelhltgnpvttlpnyateikkwfpslqildgqqirtpqeaaes
>d4wp6a_ c.10.2.0 (A:) automated matches {Chaetomium thermophilum [TaxId: 759272]} tkqkltsclarrynaeqklldlsalgtdlaeksfkalmhlvsneykdpeqkneaiqavsl arndildvgqvyslavtlprlrrldlsgnnlenlskiskwqqefrfleelhltgnpvttl pnyateikkwfpslqildgqqirtpqeaaes
Timeline for d4wp6a_: