Lineage for d4v07b_ (4v07 B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2062283Fold b.57: Herpes virus serine proteinase, assemblin [50788] (1 superfamily)
    core: barrel, closed; n=7, S=8; complex topology
  4. 2062284Superfamily b.57.1: Herpes virus serine proteinase, assemblin [50789] (2 families) (S)
    automatically mapped to Pfam PF00716
  5. 2062341Family b.57.1.0: automated matches [272851] (1 protein)
    not a true family
  6. 2062342Protein automated matches [272852] (1 species)
    not a true protein
  7. 2062343Species Suid herpesvirus 1 [TaxId:10345] [272856] (4 PDB entries)
  8. 2062349Domain d4v07b_: 4v07 B: [274972]
    automated match to d1at3a_
    complexed with cl, mg

Details for d4v07b_

PDB Entry: 4v07 (more details), 2.1 Å

PDB Description: dimeric pseudorabies virus protease pul26n at 2.1 a resolution
PDB Compounds: (B:) ul26

SCOPe Domain Sequences for d4v07b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4v07b_ b.57.1.0 (B:) automated matches {Suid herpesvirus 1 [TaxId: 10345]}
mgpvyvsgylalydrdggelaltreivaaalppagplpinidhrprcdigavlavvdddr
gpfflgvvncpqlgavlaravgpdffgdmrlsdeerllyllsnylpsaslssrrlapgea
pdetlfahvalcvigrrvgtivvydaspeaavapfrqlsararsellaraaespdrervw
hmseealtrallstavnnmllrdrwelvaarrreagvrghtylq

SCOPe Domain Coordinates for d4v07b_:

Click to download the PDB-style file with coordinates for d4v07b_.
(The format of our PDB-style files is described here.)

Timeline for d4v07b_: