Lineage for d1c5fa_ (1c5f A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 959125Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 959126Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 959127Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
  6. 959128Protein Cyclophilin (eukaryotic) [50893] (13 species)
  7. 959270Species Nematode (Brugia malayi) [TaxId:6279] [50898] (3 PDB entries)
  8. 959273Domain d1c5fa_: 1c5f A: [27497]

Details for d1c5fa_

PDB Entry: 1c5f (more details), 2.47 Å

PDB Description: crystal structure of the cyclophilin-like domain from brugia malayi complexed with cyclosporin a
PDB Compounds: (A:) peptidyl-prolyl cis-trans isomerase 1

SCOPe Domain Sequences for d1c5fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c5fa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode (Brugia malayi) [TaxId: 6279]}
mskkdrrrvfldvtidgnlagrivmelyndiaprtcnnflmlctgmagtgkisgkplhyk
gstfhrviknfmiqggdftkgdgtggesiyggmfddeefvmkhdepfvvsmankgpntng
sqffitttpaphlnnihvvfgkvvsgqevvtkieylktnsknrpladvvilncgelv

SCOPe Domain Coordinates for d1c5fa_:

Click to download the PDB-style file with coordinates for d1c5fa_.
(The format of our PDB-style files is described here.)

Timeline for d1c5fa_: