Lineage for d4uh5b_ (4uh5 B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1941879Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 1941880Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
    automatically mapped to Pfam PF02898
  5. 1941881Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)
  6. 1942574Protein automated matches [190421] (5 species)
    not a true protein
  7. 1942705Species Human (Homo sapiens) [TaxId:9606] [187302] (13 PDB entries)
  8. 1942727Domain d4uh5b_: 4uh5 B: [274965]
    automated match to d3hsob_
    complexed with cl, exi, h4b, hem, zn; mutant

Details for d4uh5b_

PDB Entry: 4uh5 (more details), 1.98 Å

PDB Description: structure of human nnos r354a g357d mutant heme domain in complex with n1-(5-(2-(6-amino-4-methylpyridin-2-yl)ethyl) pyridin-3-yl)-n1,n2-dimethylethane-1,2-diamine
PDB Compounds: (B:) neuronal nitric oxide synthase

SCOPe Domain Sequences for d4uh5b_:

Sequence, based on SEQRES records: (download)

>d4uh5b_ d.174.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rflkvknwetevvltdtlhlkstletgcteyicmgsimhpsqharrpedvatkdqlfpla
kefidqyyssikrfgskahmerleevnkeidttstyqlkdteliygakhawrnasrcvgr
iqwsklqvfdardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwnsq
liryagykqpdgstlgdpanvqfteiciqqgwkpprgrfdvlplllqangndpelfqipp
elvlevpirhpkfewfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvrdy
cdnsrynileevakkmnldmrktsslwkdqalveiniavlysfqsdkvtivdhhsatesf
ikhmeneyrcrggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvwk

Sequence, based on observed residues (ATOM records): (download)

>d4uh5b_ d.174.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rflkvknwetevvltdtlhlkstletgcteyicmgsimhpatkdqlfplakefidqyyss
ikrfgskahmerleevnkeidttstyqlkdteliygakhawrnasrcvgriqwsklqvfd
ardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwnsqliryagykqp
dgstlgdpanvqfteiciqqgwkpprgrfdvlplllqangndpelfqippelvlevpirh
pkfewfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvrdycdnsrynile
evakkmnldmrktsslwkdqalveiniavlysfqsdkvtivdhhsatesfikhmeneyrc
rggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvwk

SCOPe Domain Coordinates for d4uh5b_:

Click to download the PDB-style file with coordinates for d4uh5b_.
(The format of our PDB-style files is described here.)

Timeline for d4uh5b_: