Lineage for d1a33__ (1a33 -)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 62537Fold b.62: Cyclophilin (peptidylprolyl isomerase) [50890] (1 superfamily)
  4. 62538Superfamily b.62.1: Cyclophilin (peptidylprolyl isomerase) [50891] (1 family) (S)
  5. 62539Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (3 proteins)
  6. 62545Protein Cyclophilin (eukaryotic) [50893] (7 species)
  7. 62628Species Nematode (Brugia malayi) [TaxId:6279] [50898] (3 PDB entries)
  8. 62629Domain d1a33__: 1a33 - [27496]

Details for d1a33__

PDB Entry: 1a33 (more details), 2.15 Å

PDB Description: peptidylprolyl isomerase, cyclophilin-like domain from brugia malayi

SCOP Domain Sequences for d1a33__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a33__ b.62.1.1 (-) Cyclophilin (eukaryotic) {Nematode (Brugia malayi)}
kdrrrvfldvtidgnlagrivmelyndiaprtcnnflmlctgmagtgkisgkplhykgst
fhrviknfmiqggdftkgdgtggesiyggmfddeefvmkhdepfvvsmankgpntngsqf
fitttpaphlnnihvvfgkvvsgqevvtkieylktnsknrpladvvilncgelv

SCOP Domain Coordinates for d1a33__:

Click to download the PDB-style file with coordinates for d1a33__.
(The format of our PDB-style files is described here.)

Timeline for d1a33__: