![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.64: Saposin-like [47861] (2 superfamilies) 5 helices; folded leaf, closed |
![]() | Superfamily a.64.1: Saposin [47862] (5 families) ![]() Lipid-binding can promote conformational changes and oligomerisation in some members |
![]() | Family a.64.1.1: NKL-like [47863] (4 proteins) |
![]() | Protein automated matches [274940] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [274941] (1 PDB entry) |
![]() | Domain d4uexb1: 4uex B:1-80 [274943] Other proteins in same PDB: d4uexa2, d4uexb2 automated match to d2doba_ |
PDB Entry: 4uex (more details), 1.8 Å
SCOPe Domain Sequences for d4uexb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uexb1 a.64.1.1 (B:1-80) automated matches {Human (Homo sapiens) [TaxId: 9606]} slpcdickdvvtaagdmlkdnateeeilvylektcdwlpkpnmsasckeivdsylpvild iikgemsrpgevcsalnlce
Timeline for d4uexb1: