Lineage for d4uexb1 (4uex B:1-80)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2716976Fold a.64: Saposin-like [47861] (2 superfamilies)
    5 helices; folded leaf, closed
  4. 2716977Superfamily a.64.1: Saposin [47862] (5 families) (S)
    Lipid-binding can promote conformational changes and oligomerisation in some members
  5. 2716978Family a.64.1.1: NKL-like [47863] (4 proteins)
  6. 2717007Protein automated matches [274940] (2 species)
    not a true protein
  7. 2717008Species Human (Homo sapiens) [TaxId:9606] [274941] (1 PDB entry)
  8. 2717010Domain d4uexb1: 4uex B:1-80 [274943]
    Other proteins in same PDB: d4uexa2, d4uexb2
    automated match to d2doba_

Details for d4uexb1

PDB Entry: 4uex (more details), 1.8 Å

PDB Description: structure of human saposin a at lysosomal ph
PDB Compounds: (B:) prosaposin

SCOPe Domain Sequences for d4uexb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uexb1 a.64.1.1 (B:1-80) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slpcdickdvvtaagdmlkdnateeeilvylektcdwlpkpnmsasckeivdsylpvild
iikgemsrpgevcsalnlce

SCOPe Domain Coordinates for d4uexb1:

Click to download the PDB-style file with coordinates for d4uexb1.
(The format of our PDB-style files is described here.)

Timeline for d4uexb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4uexb2