SCOP 1.75: Domain d2rmcg_: 2rmc G:

Lineage for d2rmcg_ (2rmc G:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (4 families)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (12 proteins)

6. Protein Cyclophilin (eukaryotic) [50893] (13 species)

7. Species Mouse (Mus musculus), variant C [TaxId:10090] [50897] (1 PDB entry)

8. Domain d2rmcg_: 2rmc G: [27494]
   complexed with aba

Details for d2rmcg_

PDB Entry: 2rmc, 1.64 Å

PDB Description: crystal structure of murine cyclophilin c complexed with immunosuppressive drug cyclosporin a

PDB Compounds: (G:) cyclophilin c

SCOP Domain Sequences for d2rmcg_:

Sequence; same for both SEQRES and ATOM records:

>d2rmcg_ b.62.1.1 (G:) Cyclophilin (eukaryotic) {Mouse (Mus musculus), variant C [TaxId: 10090]}
krgpsvtdkvffdvrigdkdvgriviglfgnvvpktvenfvalatgekgygykgsifhrv
ikdfmiqggdftardgtggmsiygetfpdenfklkhygigwvsmanagpdtngsqffitl
tkptwldgkhvvfgkvldgmtvvhsielqatdghdrpltdctivnsgkidvktpfvvevp
dw

Timeline for d2rmcg_:

• d2rmcg_ first appeared (with stable ids) in SCOP 1.55
  
• d2rmcg_ appears in SCOP 1.73
  
• d2rmcg_ appears in SCOPe 2.01
  
• d2rmcg_ appears in the current release, SCOPe 2.08