SCOPe 2.05: Domain d4tyfa_: 4tyf A:

Lineage for d4tyfa_ (4tyf A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.0: automated matches [191360] (1 protein)
   not a true family

6. Protein automated matches [190418] (15 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [226145] (6 PDB entries)

8. Domain d4tyfa_: 4tyf A: [274939]
   automated match to d3zr9a_
   complexed with zn

Details for d4tyfa_

PDB Entry: 4tyf, 1.1 Å

PDB Description: structure of a metallo-beta-lactamase

PDB Compounds: (A:) ndm-4

SCOPe Domain Sequences for d4tyfa_:

Sequence; same for both SEQRES and ATOM records:

>d4tyfa_ d.157.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
pgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqtaq
ilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqeglvaaqhs
ltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgn
lgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr

Timeline for d4tyfa_:

• d4tyfa_ is new in SCOPe 2.05-stable
  
• d4tyfa_ is called d4tyfa1 in SCOPe 2.06
  
• d4tyfa_ appears in the current release, SCOPe 2.08, called d4tyfa1