Class a: All alpha proteins [46456] (289 folds) |
Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.7.4: Smac/diablo [46984] (1 family) automatically mapped to Pfam PF09057 |
Family a.7.4.1: Smac/diablo [46985] (2 proteins) this is a repeat family; one repeat unit is 1few A: found in domain |
Protein automated matches [274935] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [274936] (1 PDB entry) |
Domain d4tx5b_: 4tx5 B: [274938] Other proteins in same PDB: d4tx5a2 automated match to d1fewa_ complexed with act, mpd |
PDB Entry: 4tx5 (more details), 1.8 Å
SCOPe Domain Sequences for d4tx5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4tx5b_ a.7.4.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} lssealmrravslvtdststflsqttyalieaiteytkavytltslyrqytsllgkmnse eedevwqviigaraemtskhqeylklettwmtavglsemaaeaayqtgadqasitarnhi qlvklqveevhqlsrkaetklaeaqieelrqktqeegeeraeseqea
Timeline for d4tx5b_: