SCOPe 2.06: Domain d4tx5b_: 4tx5 B:

Lineage for d4tx5b_ (4tx5 B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.4: Smac/diablo [46984] (1 family)
   automatically mapped to Pfam PF09057

5. Family a.7.4.1: Smac/diablo [46985] (2 proteins)
   this is a repeat family; one repeat unit is 1few A: found in domain

6. Protein automated matches [274935] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [274936] (1 PDB entry)

8. Domain d4tx5b_: 4tx5 B: [274938]
   Other proteins in same PDB: d4tx5a2
   automated match to d1fewa_
   complexed with act, mpd

Details for d4tx5b_

PDB Entry: 4tx5, 1.8 Å

PDB Description: crystal structure of smac-diablo (in space group p65)

PDB Compounds: (B:) Diablo homolog, mitochondrial

SCOPe Domain Sequences for d4tx5b_:

Sequence; same for both SEQRES and ATOM records:

>d4tx5b_ a.7.4.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lssealmrravslvtdststflsqttyalieaiteytkavytltslyrqytsllgkmnse
eedevwqviigaraemtskhqeylklettwmtavglsemaaeaayqtgadqasitarnhi
qlvklqveevhqlsrkaetklaeaqieelrqktqeegeeraeseqea

Timeline for d4tx5b_:

• d4tx5b_ first appeared in SCOPe 2.05
  
• d4tx5b_ appears in SCOPe 2.07
  
• d4tx5b_ appears in the current release, SCOPe 2.08