SCOPe 2.08: Domain d4tuob1: 4tuo B:1-113

Lineage for d4tuob1 (4tuo B:1-113)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)

8. Domain d4tuob1: 4tuo B:1-113 [274925]
   Other proteins in same PDB: d4tuob2, d4tuod2
   automated match to d1t66c1
   complexed with na

Details for d4tuob1

PDB Entry: 4tuo, 1.55 Å

PDB Description: crystal structure of monoclonal antibody against neuroblastoma associated antigen.

PDB Compounds: (B:) Light chain of monoclonal antibody against neuroblastoma associated antigen

SCOPe Domain Sequences for d4tuob1:

Sequence; same for both SEQRES and ATOM records:

>d4tuob1 b.1.1.1 (B:1-113) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvvmtqtplslpvslgdqasiscrssqslvhrngntylhwylqkpgqspkllihkvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvppltfgagtklelk

Timeline for d4tuob1:

• d4tuob1 first appeared in SCOPe 2.05
  
• d4tuob1 appears in SCOPe 2.07