Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (24 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries) |
Domain d4tuob1: 4tuo B:1-113 [274925] Other proteins in same PDB: d4tuob2, d4tuod2 automated match to d1t66c1 complexed with na |
PDB Entry: 4tuo (more details), 1.55 Å
SCOPe Domain Sequences for d4tuob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4tuob1 b.1.1.1 (B:1-113) automated matches {Mouse (Mus musculus) [TaxId: 10090]} dvvmtqtplslpvslgdqasiscrssqslvhrngntylhwylqkpgqspkllihkvsnrf sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvppltfgagtklelk
Timeline for d4tuob1:
View in 3D Domains from other chains: (mouse over for more information) d4tuoa_, d4tuoc_, d4tuod1, d4tuod2 |