SCOPe 2.08: Domain d4rfel2: 4rfe L:108-208

Lineage for d4rfel2 (4rfe L:108-208)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [226134] (27 PDB entries)

8. Domain d4rfel2: 4rfe L:108-208 [274918]
   Other proteins in same PDB: d4rfea_, d4rfeb1, d4rfec_, d4rfed1, d4rfee_, d4rfef1, d4rfeh_, d4rfel1
   automated match to d2fb4l2
   complexed with cl, gol, so4

Details for d4rfel2

PDB Entry: 4rfe, 1.91 Å

PDB Description: crystal structure of adcc-potent anti-hiv-1 rhesus macaque antibody jr4 fab

PDB Compounds: (L:) Fab light chain of ADCC-potent anti-HIV-1 antibody JR4

SCOPe Domain Sequences for d4rfel2:

Sequence; same for both SEQRES and ATOM records:

>d4rfel2 b.1.1.2 (L:108-208) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
qpkasplvtlfppsseelqankatlvclisdfypgvvkvawkadgnsvntgvetttpskq
snnkyaassylsltsdqwkshksyscqvthegstvektvap

Timeline for d4rfel2:

• d4rfel2 first appeared in SCOPe 2.05
  
• d4rfel2 appears in SCOPe 2.07