Lineage for d4rfel1 (4rfe L:3-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2761531Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [226133] (37 PDB entries)
  8. 2761550Domain d4rfel1: 4rfe L:3-107 [274917]
    Other proteins in same PDB: d4rfeb2, d4rfed2, d4rfef2, d4rfel2
    automated match to d2mcg11
    complexed with cl, gol, so4

Details for d4rfel1

PDB Entry: 4rfe (more details), 1.91 Å

PDB Description: crystal structure of adcc-potent anti-hiv-1 rhesus macaque antibody jr4 fab
PDB Compounds: (L:) Fab light chain of ADCC-potent anti-HIV-1 antibody JR4

SCOPe Domain Sequences for d4rfel1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rfel1 b.1.1.0 (L:3-107) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
vltqppsvsaapgqkvtiscsgsssnigrsyvswyqqvpgaapklliydtnkrpsgvsdr
fsgsksgssaslaitglqtgdeadyycgawdgslnvhifgsgtkltvlg

SCOPe Domain Coordinates for d4rfel1:

Click to download the PDB-style file with coordinates for d4rfel1.
(The format of our PDB-style files is described here.)

Timeline for d4rfel1: