Lineage for d4rfeb2 (4rfe B:108-208)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2753422Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [226134] (27 PDB entries)
  8. 2753427Domain d4rfeb2: 4rfe B:108-208 [274916]
    Other proteins in same PDB: d4rfea_, d4rfeb1, d4rfec_, d4rfed1, d4rfee_, d4rfef1, d4rfeh_, d4rfel1
    automated match to d2fb4l2
    complexed with cl, gol, so4

Details for d4rfeb2

PDB Entry: 4rfe (more details), 1.91 Å

PDB Description: crystal structure of adcc-potent anti-hiv-1 rhesus macaque antibody jr4 fab
PDB Compounds: (B:) Fab light chain of ADCC-potent anti-HIV-1 antibody JR4

SCOPe Domain Sequences for d4rfeb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rfeb2 b.1.1.2 (B:108-208) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
qpkasplvtlfppsseelqankatlvclisdfypgvvkvawkadgnsvntgvetttpskq
snnkyaassylsltsdqwkshksyscqvthegstvektvap

SCOPe Domain Coordinates for d4rfeb2:

Click to download the PDB-style file with coordinates for d4rfeb2.
(The format of our PDB-style files is described here.)

Timeline for d4rfeb2: