Lineage for d2rmca_ (2rmc A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 806745Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 806746Superfamily b.62.1: Cyclophilin-like [50891] (4 families) (S)
  5. 806747Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (12 proteins)
  6. 806748Protein Cyclophilin (eukaryotic) [50893] (13 species)
  7. 806875Species Mouse (Mus musculus), variant C [TaxId:10090] [50897] (1 PDB entry)
  8. 806876Domain d2rmca_: 2rmc A: [27491]

Details for d2rmca_

PDB Entry: 2rmc (more details), 1.64 Å

PDB Description: crystal structure of murine cyclophilin c complexed with immunosuppressive drug cyclosporin a
PDB Compounds: (A:) cyclophilin c

SCOP Domain Sequences for d2rmca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rmca_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus musculus), variant C [TaxId: 10090]}
krgpsvtdkvffdvrigdkdvgriviglfgnvvpktvenfvalatgekgygykgsifhrv
ikdfmiqggdftardgtggmsiygetfpdenfklkhygigwvsmanagpdtngsqffitl
tkptwldgkhvvfgkvldgmtvvhsielqatdghdrpltdctivnsgkidvktpfvvevp
dw

SCOP Domain Coordinates for d2rmca_:

Click to download the PDB-style file with coordinates for d2rmca_.
(The format of our PDB-style files is described here.)

Timeline for d2rmca_: