Lineage for d4rb2d_ (4rb2 D:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1721437Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1722860Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1722861Protein automated matches [190154] (57 species)
    not a true protein
  7. 1723053Species Magnetospirillum gryphiswaldense [TaxId:1430440] [274898] (6 PDB entries)
  8. 1723065Domain d4rb2d_: 4rb2 D: [274908]
    automated match to d3mwma_
    protein/DNA complex; complexed with mn

Details for d4rb2d_

PDB Entry: 4rb2 (more details), 2.82 Å

PDB Description: crystal structure of magnetospirillum gryphiswaldense msr-1 semet-fur- mn2+-feoab1 operator
PDB Compounds: (D:) DNA-binding transcriptional dual regulator of siderophore biosynthesis and transport(Fur family)

SCOPe Domain Sequences for d4rb2d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rb2d_ a.4.5.0 (D:) automated matches {Magnetospirillum gryphiswaldense [TaxId: 1430440]}
mvsrieqrcidkgmkmtdqrrviaqvlsdsadhpdveevyrratakdprisiatvyrtvr
lfeeesilerhdfgdgraryeeapsehhdhlidvnsarvieftspeiealqreiarkhgf
rlvghrlelygvpl

SCOPe Domain Coordinates for d4rb2d_:

Click to download the PDB-style file with coordinates for d4rb2d_.
(The format of our PDB-style files is described here.)

Timeline for d4rb2d_: