| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
| Protein automated matches [190154] (92 species) not a true protein |
| Species Magnetospirillum gryphiswaldense [TaxId:1430440] [274898] (6 PDB entries) |
| Domain d4rb3d_: 4rb3 D: [274907] automated match to d4etsa_ protein/DNA complex; complexed with mn, so4 |
PDB Entry: 4rb3 (more details), 2.6 Å
SCOPe Domain Sequences for d4rb3d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rb3d_ a.4.5.0 (D:) automated matches {Magnetospirillum gryphiswaldense [TaxId: 1430440]}
vsrieqrlidkglkvtdqrrviaqvlsdsadhpdveevyrratakdprisiatvyrtvrl
feeesilerhdfgdgraryeeapsehhdhlidvnsarvieftspeiealqreiarkhgfr
lvghrlelygvpl
Timeline for d4rb3d_: