Lineage for d4rb0b_ (4rb0 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306394Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307971Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2307972Protein automated matches [190154] (87 species)
    not a true protein
  7. 2308278Species Magnetospirillum gryphiswaldense [TaxId:1430440] [274898] (6 PDB entries)
  8. 2308282Domain d4rb0b_: 4rb0 B: [274903]
    Other proteins in same PDB: d4rb0a2
    automated match to d3mwma_
    complexed with flc, so4

Details for d4rb0b_

PDB Entry: 4rb0 (more details), 1.85 Å

PDB Description: crystal structure of magnetospirillum gryphiswaldense msr-1 semet-apo- fur
PDB Compounds: (B:) DNA-binding transcriptional dual regulator of siderophore biosynthesis and transport(Fur family)

SCOPe Domain Sequences for d4rb0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rb0b_ a.4.5.0 (B:) automated matches {Magnetospirillum gryphiswaldense [TaxId: 1430440]}
vsrieqrcidkgmkmtdqrrviaqvlsdsadhpdveevyrratakdprisiatvyrtvrl
feeesilerhdfgdgraryeeapsehhdhlidvnsarvieftspeiealqreiarkhgfr
lvghrlelygvpl

SCOPe Domain Coordinates for d4rb0b_:

Click to download the PDB-style file with coordinates for d4rb0b_.
(The format of our PDB-style files is described here.)

Timeline for d4rb0b_: