Lineage for d4razb_ (4raz B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304501Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305606Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307165Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2307166Protein automated matches [190154] (76 species)
    not a true protein
  7. 2307406Species Magnetospirillum gryphiswaldense [TaxId:1430440] [274898] (6 PDB entries)
  8. 2307412Domain d4razb_: 4raz B: [274902]
    automated match to d4etsa_
    complexed with edo, mn

Details for d4razb_

PDB Entry: 4raz (more details), 1.9 Å

PDB Description: crystal structure of magnetospirillum gryphiswaldense msr-1 holo-fur
PDB Compounds: (B:) DNA-binding transcriptional dual regulator of siderophore biosynthesis and transport(Fur family)

SCOPe Domain Sequences for d4razb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4razb_ a.4.5.0 (B:) automated matches {Magnetospirillum gryphiswaldense [TaxId: 1430440]}
mvsrieqrlidkglkvtdqrrviaqvlsdsadhpdveevyrratakdprisiatvyrtvr
lfeeesilerhdfgdgraryeeapsehhdhlidvnsarvieftspeiealqreiarkhgf
rlvghrlelygvpl

SCOPe Domain Coordinates for d4razb_:

Click to download the PDB-style file with coordinates for d4razb_.
(The format of our PDB-style files is described here.)

Timeline for d4razb_: