Lineage for d4raya1 (4ray A:1-134)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. 2694885Species Magnetospirillum gryphiswaldense [TaxId:1430440] [274898] (6 PDB entries)
  8. 2694886Domain d4raya1: 4ray A:1-134 [274899]
    Other proteins in same PDB: d4raya2
    automated match to d2w57a_
    complexed with flc, so4

Details for d4raya1

PDB Entry: 4ray (more details), 1.55 Å

PDB Description: crystal structure of magnetospirillum gryphiswaldense msr-1 apo-fur
PDB Compounds: (A:) DNA-binding transcriptional dual regulator of siderophore biosynthesis and transport(Fur family)

SCOPe Domain Sequences for d4raya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4raya1 a.4.5.0 (A:1-134) automated matches {Magnetospirillum gryphiswaldense [TaxId: 1430440]}
mvsrieqrcidkgmkmtdqrrviaqvlsdsadhpdveevyrratakdprisiatvyrtvr
lfeeesilerhdfgdgraryeeapsehhdhlidvnsarvieftspeiealqreiarkhgf
rlvghrlelygvpl

SCOPe Domain Coordinates for d4raya1:

Click to download the PDB-style file with coordinates for d4raya1.
(The format of our PDB-style files is described here.)

Timeline for d4raya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4raya2
View in 3D
Domains from other chains:
(mouse over for more information)
d4rayb_