![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
![]() | Protein automated matches [190154] (92 species) not a true protein |
![]() | Species Magnetospirillum gryphiswaldense [TaxId:1430440] [274898] (6 PDB entries) |
![]() | Domain d4raya1: 4ray A:1-134 [274899] Other proteins in same PDB: d4raya2 automated match to d2w57a_ complexed with flc, so4 |
PDB Entry: 4ray (more details), 1.55 Å
SCOPe Domain Sequences for d4raya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4raya1 a.4.5.0 (A:1-134) automated matches {Magnetospirillum gryphiswaldense [TaxId: 1430440]} mvsrieqrcidkgmkmtdqrrviaqvlsdsadhpdveevyrratakdprisiatvyrtvr lfeeesilerhdfgdgraryeeapsehhdhlidvnsarvieftspeiealqreiarkhgf rlvghrlelygvpl
Timeline for d4raya1: