SCOPe 2.08: Domain d4qi3b1: 4qi3 B:2-208

Lineage for d4qi3b1 (4qi3 B:2-208)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.9: CBD9-like [49344] (4 families)
   has additional strand at N-terminus; the active site in a similar topological location as the Cu,Zn SOD site

5. Family b.1.9.0: automated matches [274885] (1 protein)
   not a true family

6. Protein automated matches [274886] (2 species)
   not a true protein

7. Species Myriococcum thermophilum [TaxId:455373] [274887] (1 PDB entry)

8. Domain d4qi3b1: 4qi3 B:2-208 [274889]
   Other proteins in same PDB: d4qi3a2, d4qi3b2
   automated match to d1d7ca_
   complexed with hem, man, mg, nag

Details for d4qi3b1

PDB Entry: 4qi3, 1.4 Å

PDB Description: cytochrome domain of myriococcum thermophilum cellobiose dehydrogenase, mtcyt

PDB Compounds: (B:) cellobiose dehydrogenase

SCOPe Domain Sequences for d4qi3b1:

Sequence; same for both SEQRES and ATOM records:

>d4qi3b1 b.1.9.0 (B:2-208) automated matches {Myriococcum thermophilum [TaxId: 455373]}
nnvpntftdpdsgitfntwgldedspqtqggftfgvalpsdalttdasefigylkcarnd
esgwcgislggpmtnsllitawphedtvytslrfatgyampdvyegdaeitqvsssvnst
hfslifrcknclqwshggssggastsggvlvlgwvqafddpgnptcpeqitlqqhdngmg
iwgaqlntdaaspsytdwaaqatktvt

Timeline for d4qi3b1:

• d4qi3b1 first appeared in SCOPe 2.05, called d4qi3b_
  
• d4qi3b1 appears in SCOPe 2.07