![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.9: CBD9-like [49344] (4 families) ![]() has additional strand at N-terminus; the active site in a similar topological location as the Cu,Zn SOD site |
![]() | Family b.1.9.0: automated matches [274885] (1 protein) not a true family |
![]() | Protein automated matches [274886] (2 species) not a true protein |
![]() | Species Myriococcum thermophilum [TaxId:455373] [274887] (1 PDB entry) |
![]() | Domain d4qi3a1: 4qi3 A:2-208 [274888] Other proteins in same PDB: d4qi3a2, d4qi3b2 automated match to d1d7ca_ complexed with hem, man, mg, nag |
PDB Entry: 4qi3 (more details), 1.4 Å
SCOPe Domain Sequences for d4qi3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qi3a1 b.1.9.0 (A:2-208) automated matches {Myriococcum thermophilum [TaxId: 455373]} nnvpntftdpdsgitfntwgldedspqtqggftfgvalpsdalttdasefigylkcarnd esgwcgislggpmtnsllitawphedtvytslrfatgyampdvyegdaeitqvsssvnst hfslifrcknclqwshggssggastsggvlvlgwvqafddpgnptcpeqitlqqhdngmg iwgaqlntdaaspsytdwaaqatktvt
Timeline for d4qi3a1: