Lineage for d4qi3a1 (4qi3 A:2-208)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2764503Superfamily b.1.9: CBD9-like [49344] (4 families) (S)
    has additional strand at N-terminus; the active site in a similar topological location as the Cu,Zn SOD site
  5. 2764526Family b.1.9.0: automated matches [274885] (1 protein)
    not a true family
  6. 2764527Protein automated matches [274886] (2 species)
    not a true protein
  7. 2764530Species Myriococcum thermophilum [TaxId:455373] [274887] (1 PDB entry)
  8. 2764531Domain d4qi3a1: 4qi3 A:2-208 [274888]
    Other proteins in same PDB: d4qi3a2, d4qi3b2
    automated match to d1d7ca_
    complexed with hem, man, mg, nag

Details for d4qi3a1

PDB Entry: 4qi3 (more details), 1.4 Å

PDB Description: cytochrome domain of myriococcum thermophilum cellobiose dehydrogenase, mtcyt
PDB Compounds: (A:) cellobiose dehydrogenase

SCOPe Domain Sequences for d4qi3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qi3a1 b.1.9.0 (A:2-208) automated matches {Myriococcum thermophilum [TaxId: 455373]}
nnvpntftdpdsgitfntwgldedspqtqggftfgvalpsdalttdasefigylkcarnd
esgwcgislggpmtnsllitawphedtvytslrfatgyampdvyegdaeitqvsssvnst
hfslifrcknclqwshggssggastsggvlvlgwvqafddpgnptcpeqitlqqhdngmg
iwgaqlntdaaspsytdwaaqatktvt

SCOPe Domain Coordinates for d4qi3a1:

Click to download the PDB-style file with coordinates for d4qi3a1.
(The format of our PDB-style files is described here.)

Timeline for d4qi3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4qi3a2