Lineage for d3cysa_ (3cys A:)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) 
Fold b.62: Cyclophilin (peptidylprolyl isomerase) [50890] (1 superfamily) Superfamily b.62.1: Cyclophilin (peptidylprolyl isomerase) [50891] (1 family) 
Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (3 proteins) Protein Cyclophilin (eukaryotic) [50893] (7 species) Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (33 PDB entries) 
Domain d3cysa_: 3cys A: [27488]
Details for d3cysa_
PDB Entry: 3cys (more details)
PDB Description: determination of the nmr solution structure of the cyclophilin a- cyclosporin a complex
SCOP Domain Sequences for d3cysa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cysa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A}
mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
SCOP Domain Coordinates for d3cysa_:
Click to download the PDB-style file with coordinates for d3cysa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3cysa_:
- d3cysa_ first appeared (with stable ids) in SCOP 1.55
- d3cysa_ appears in SCOP 1.57
- d3cysa_ appears in SCOP 1.61
- d3cysa_ appears in the current release, SCOPe 2.08
View in 3D