SCOPe 2.05: Domain d5bxvc_: 5bxv C:

Lineage for d5bxvc_ (5bxv C:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.86: eIF4e-like [55417] (1 superfamily)
   beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478

4. Superfamily d.86.1: eIF4e-like [55418] (3 families)

5. Family d.86.1.1: Translation initiation factor eIF4e [55419] (2 proteins)
   automatically mapped to Pfam PF01652

6. Protein Translation initiation factor eIF4e [55420] (3 species)
   messenger RNA 5' cap-binding protein

7. Species Mouse (Mus musculus) [TaxId:10090] [55421] (5 PDB entries)

8. Domain d5bxvc_: 5bxv C: [274871]
   automated match to d1ipca_
   complexed with mgp

Details for d5bxvc_

PDB Entry: 5bxv, 2.1 Å

PDB Description: eif4e complex

PDB Compounds: (C:) eukaryotic translation initiation factor 4e

SCOPe Domain Sequences for d5bxvc_:

Sequence, based on SEQRES records:

>d5bxvc_ d.86.1.1 (C:) Translation initiation factor eIF4e {Mouse (Mus musculus) [TaxId: 10090]}
hyikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmpgcdys
lfkdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddysddvcga
vvnvrakgdkiaiwttecenrdavthigrvykerlglppkivigyqshadtatksgsttk
nrfvv

Sequence, based on observed residues (ATOM records):

>d5bxvc_ d.86.1.1 (C:) Translation initiation factor eIF4e {Mouse (Mus musculus) [TaxId: 10090]}
hyikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmpgcdys
lfkdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddysddvcga
vvnvrakgdkiaiwttecenrdavthigrvykerlglppkivigyqshadtatttknrfv
v

Timeline for d5bxvc_:

• d5bxvc_ is new in SCOPe 2.05-stable
  
• d5bxvc_ appears in SCOPe 2.06
  
• d5bxvc_ appears in the current release, SCOPe 2.08