SCOP 1.71: Domain d1oca__: 1oca -

Lineage for d1oca__ (1oca -)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (2 families)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (3 proteins)

6. Protein Cyclophilin (eukaryotic) [50893] (10 species)

7. Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (45 PDB entries)

8. Domain d1oca__: 1oca - [27487]

Details for d1oca__

PDB Entry: 1oca

PDB Description: human cyclophilin a, unligated, nmr, 20 structures

SCOP Domain Sequences for d1oca__:

Sequence; same for both SEQRES and ATOM records:

>d1oca__ b.62.1.1 (-) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A}
mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

Timeline for d1oca__:

• d1oca__ first appeared (with stable ids) in SCOP 1.55
  
• d1oca__ appears in SCOP 1.69
  
• d1oca__ is called d1ocaa_ in SCOP 1.73
  
• d1oca__ appears in the current release, SCOPe 2.08, called d1ocaa_