Lineage for d1oca__ (1oca -)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 379249Fold b.62: Cyclophilin (peptidylprolyl isomerase) [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 379250Superfamily b.62.1: Cyclophilin (peptidylprolyl isomerase) [50891] (1 family) (S)
  5. 379251Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (3 proteins)
  6. 379258Protein Cyclophilin (eukaryotic) [50893] (9 species)
  7. 379271Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (42 PDB entries)
  8. 379360Domain d1oca__: 1oca - [27487]

Details for d1oca__

PDB Entry: 1oca (more details)

PDB Description: human cyclophilin a, unligated, nmr, 20 structures

SCOP Domain Sequences for d1oca__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oca__ b.62.1.1 (-) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A}
mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

SCOP Domain Coordinates for d1oca__:

Click to download the PDB-style file with coordinates for d1oca__.
(The format of our PDB-style files is described here.)

Timeline for d1oca__: