Lineage for d5bq2d1 (5bq2 D:1-421)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2957073Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 2957090Superfamily d.68.2: EPT/RTPC-like [55205] (3 families) (S)
  5. 2957100Family d.68.2.2: Enolpyruvate transferase, EPT [55209] (3 proteins)
    duplication: 6 repeats of this fold are organized in two RPTC-like domains
    automatically mapped to Pfam PF00275
  6. 2957232Protein automated matches [190917] (11 species)
    not a true protein
  7. 2957277Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [274850] (1 PDB entry)
  8. 2957281Domain d5bq2d1: 5bq2 D:1-421 [274851]
    Other proteins in same PDB: d5bq2a2, d5bq2b2, d5bq2c2, d5bq2d2
    automated match to d1dlga_
    complexed with epu, mg

Details for d5bq2d1

PDB Entry: 5bq2 (more details), 1.7 Å

PDB Description: crystal structure of udp-n-acetylglucosamine 1-carboxyvinyltransferase (udp-n-acetylglucosamine enolpyruvyl transferase, ept) from pseudomonas aeruginosa
PDB Compounds: (D:) UDP-N-acetylglucosamine 1-carboxyvinyltransferase

SCOPe Domain Sequences for d5bq2d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bq2d1 d.68.2.2 (D:1-421) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
mdkliitggnrldgeirisgaknsalpilaatlladtpvtvcnlphlhdittmielfgrm
gvqpiideklnvevdassiktlvapyelvktmrasilvlgpmlarfgeaevalpggxaig
srpvdlhirgleamgaqieveggyikakapagglrgghfffdtvsvtgtenlmmaaalan
grtvlqnaarepevvdlanclnamganvqgagsdtiviegvkrlggarydvlpdrietgt
ylvaaaatggrvklkdtdptileavlqkleeagahistgsnwieldmkgnrpkavnvrta
pypafptdmqaqfismnavaegtgavietvfenrfmhvyemnrmgaqilvegntaivtgv
pklkgapvmatdlrasaslviaglvaegdtlidriyhidrgyecieeklqllgakirrvp
g

SCOPe Domain Coordinates for d5bq2d1:

Click to download the PDB-style file with coordinates for d5bq2d1.
(The format of our PDB-style files is described here.)

Timeline for d5bq2d1: