Lineage for d4zkbb_ (4zkb B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1890825Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 1890826Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 1890827Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)
  6. 1891108Protein automated matches [190403] (3 species)
    not a true protein
  7. 1891109Species Human (Homo sapiens) [TaxId:9606] [187277] (18 PDB entries)
  8. 1891140Domain d4zkbb_: 4zkb B: [274840]
    automated match to d1b53a_
    complexed with bma, nag

Details for d4zkbb_

PDB Entry: 4zkb (more details), 2.9 Å

PDB Description: the chemokine binding protein of orf virus complexed with ccl3
PDB Compounds: (B:) C-C motif chemokine 3

SCOPe Domain Sequences for d4zkbb_:

Sequence, based on SEQRES records: (download)

>d4zkbb_ d.9.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
taccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvqkyvsd

Sequence, based on observed residues (ATOM records): (download)

>d4zkbb_ d.9.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
taccfsytsrqipdyfetssqcskpgvifltrqvcadpseewvqkyvsd

SCOPe Domain Coordinates for d4zkbb_:

Click to download the PDB-style file with coordinates for d4zkbb_.
(The format of our PDB-style files is described here.)

Timeline for d4zkbb_: