Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.9: IL8-like [54116] (2 superfamilies) beta(3)-alpha |
Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) form dimers with different dimerisation modes |
Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins) |
Protein automated matches [190403] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187277] (18 PDB entries) |
Domain d4zkbb_: 4zkb B: [274840] automated match to d1b53a_ complexed with bma, nag |
PDB Entry: 4zkb (more details), 2.9 Å
SCOPe Domain Sequences for d4zkbb_:
Sequence, based on SEQRES records: (download)
>d4zkbb_ d.9.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} taccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvqkyvsd
>d4zkbb_ d.9.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} taccfsytsrqipdyfetssqcskpgvifltrqvcadpseewvqkyvsd
Timeline for d4zkbb_: