Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (14 species) not a true protein |
Species Homo sapiens [TaxId:9606] [268989] (70 PDB entries) |
Domain d4z5rv2: 4z5r V:107-213 [274838] Other proteins in same PDB: d4z5ra1, d4z5rd_, d4z5re_, d4z5rf_, d4z5rg_, d4z5rh_, d4z5ri_, d4z5rj1, d4z5rl1, d4z5rn_, d4z5rp1, d4z5rr1, d4z5rt1, d4z5rv1, d4z5rx_, d4z5ry_ automated match to d1dn0a2 complexed with so4 |
PDB Entry: 4z5r (more details), 3 Å
SCOPe Domain Sequences for d4z5rv2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4z5rv2 b.1.1.2 (V:107-213) automated matches {Homo sapiens [TaxId: 9606]} krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge
Timeline for d4z5rv2: