| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
| Domain d4z5rv1: 4z5r V:1-106 [274837] Other proteins in same PDB: d4z5ra2, d4z5rb_, d4z5rd_, d4z5re_, d4z5rf_, d4z5rg_, d4z5rh_, d4z5ri_, d4z5rj2, d4z5rk_, d4z5rl2, d4z5rm_, d4z5rn_, d4z5rp2, d4z5rq_, d4z5rr2, d4z5rs_, d4z5rt2, d4z5ru_, d4z5rv2, d4z5rw_, d4z5rx_, d4z5rz_ automated match to d1dn0a1 complexed with so4 |
PDB Entry: 4z5r (more details), 3 Å
SCOPe Domain Sequences for d4z5rv1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4z5rv1 b.1.1.0 (V:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcrasqsvstssysymhwyqqkpgkapkvlisyasnles
gvpsrfsgsgsgtdftltisslqpedfatyycqhswgiprtfgqgtkvei
Timeline for d4z5rv1:
View in 3DDomains from other chains: (mouse over for more information) d4z5ra1, d4z5ra2, d4z5rb_, d4z5rd_, d4z5re_, d4z5rf_, d4z5rg_, d4z5rh_, d4z5ri_, d4z5rj1, d4z5rj2, d4z5rk_, d4z5rl1, d4z5rl2, d4z5rm_, d4z5rn_, d4z5rp1, d4z5rp2, d4z5rq_, d4z5rr1, d4z5rr2, d4z5rs_, d4z5rt1, d4z5rt2, d4z5ru_, d4z5rw_, d4z5rx_, d4z5ry_, d4z5rz_ |