Lineage for d4z5rp2 (4z5r P:107-213)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2752213Domain d4z5rp2: 4z5r P:107-213 [274830]
    Other proteins in same PDB: d4z5ra1, d4z5rb_, d4z5rd_, d4z5re_, d4z5rf_, d4z5rg_, d4z5rh_, d4z5ri_, d4z5rj1, d4z5rk_, d4z5rl1, d4z5rm_, d4z5rn_, d4z5rp1, d4z5rq_, d4z5rr1, d4z5rs_, d4z5rt1, d4z5ru_, d4z5rv1, d4z5rw_, d4z5rx_, d4z5ry_, d4z5rz_
    automated match to d1dn0a2
    complexed with so4

Details for d4z5rp2

PDB Entry: 4z5r (more details), 3 Å

PDB Description: rontalizumab fab bound to interferon-a2
PDB Compounds: (P:) anti-IFN-a antibody rontalizumab light chain

SCOPe Domain Sequences for d4z5rp2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4z5rp2 b.1.1.2 (P:107-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d4z5rp2:

Click to download the PDB-style file with coordinates for d4z5rp2.
(The format of our PDB-style files is described here.)

Timeline for d4z5rp2: