SCOPe 2.08: Domain d4z5rp1: 4z5r P:1-106

Lineage for d4z5rp1 (4z5r P:1-106)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4z5rp1: 4z5r P:1-106 [274829]
   Other proteins in same PDB: d4z5ra2, d4z5rb_, d4z5rd_, d4z5re_, d4z5rf_, d4z5rg_, d4z5rh_, d4z5ri_, d4z5rj2, d4z5rk_, d4z5rl2, d4z5rm_, d4z5rn_, d4z5rp2, d4z5rq_, d4z5rr2, d4z5rs_, d4z5rt2, d4z5ru_, d4z5rv2, d4z5rw_, d4z5rx_, d4z5rz_
   automated match to d1dn0a1
   complexed with so4

Details for d4z5rp1

PDB Entry: 4z5r, 3 Å

PDB Description: rontalizumab fab bound to interferon-a2

PDB Compounds: (P:) anti-IFN-a antibody rontalizumab light chain

SCOPe Domain Sequences for d4z5rp1:

Sequence; same for both SEQRES and ATOM records:

>d4z5rp1 b.1.1.0 (P:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcrasqsvstssysymhwyqqkpgkapkvlisyasnles
gvpsrfsgsgsgtdftltisslqpedfatyycqhswgiprtfgqgtkvei

Timeline for d4z5rp1:

• d4z5rp1 first appeared in SCOPe 2.05
  
• d4z5rp1 appears in SCOPe 2.07