SCOPe 2.08: Domain d4z5rn_: 4z5r N:

Lineage for d4z5rn_ (4z5r N:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins)
   contains an additional helix in one of the crossover connections

6. Protein Interferon-alpha 2a [47314] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47315] (9 PDB entries)

8. Domain d4z5rn_: 4z5r N: [274822]
   Other proteins in same PDB: d4z5ra1, d4z5ra2, d4z5rb_, d4z5rj1, d4z5rj2, d4z5rk_, d4z5rl1, d4z5rl2, d4z5rm_, d4z5rp1, d4z5rp2, d4z5rq_, d4z5rr1, d4z5rr2, d4z5rs_, d4z5rt1, d4z5rt2, d4z5ru_, d4z5rv1, d4z5rv2, d4z5rw_, d4z5ry_, d4z5rz_
   automated match to d1itfa_
   complexed with so4

Details for d4z5rn_

PDB Entry: 4z5r, 3 Å

PDB Description: rontalizumab fab bound to interferon-a2

PDB Compounds: (N:) Interferon alpha-2

SCOPe Domain Sequences for d4z5rn_:

Sequence, based on SEQRES records:

>d4z5rn_ a.26.1.3 (N:) Interferon-alpha 2a {Human (Homo sapiens) [TaxId: 9606]}
lgsrrtlmllaqmrkislfsclkdrhdfgfpqeefgnqfqkaetipvlhemiqqifnlfs
tkdssaawdetlldkfytelyqqlndleacviqgvgvtetplmkedsilavrkyfqritl
ylkekkyspcawevvraeimrsfslstnlqesl

Sequence, based on observed residues (ATOM records):

>d4z5rn_ a.26.1.3 (N:) Interferon-alpha 2a {Human (Homo sapiens) [TaxId: 9606]}
lgsrrtlmllaqmrkislfsclkdrhdfgfpqeefgnqfqkaetipvlhemiqqifnlfs
tkdssaawdetlldkfytelyqqlndleacviqgmkedsilavrkyfqritlylkekkys
pcawevvraeimrsfslstnlqesl

Timeline for d4z5rn_:

• d4z5rn_ first appeared in SCOPe 2.05
  
• d4z5rn_ appears in SCOPe 2.07