![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
![]() | Superfamily a.26.1: 4-helical cytokines [47266] (4 families) ![]() there are two different topoisomers of this fold with different entanglements of the two crossover connections |
![]() | Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins) contains an additional helix in one of the crossover connections |
![]() | Protein Interferon-alpha 2a [47314] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47315] (9 PDB entries) |
![]() | Domain d4z5rd_: 4z5r D: [274819] Other proteins in same PDB: d4z5ra1, d4z5ra2, d4z5rb_, d4z5rj1, d4z5rj2, d4z5rk_, d4z5rl1, d4z5rl2, d4z5rm_, d4z5rp1, d4z5rp2, d4z5rq_, d4z5rr1, d4z5rr2, d4z5rs_, d4z5rt1, d4z5rt2, d4z5ru_, d4z5rv1, d4z5rv2, d4z5rw_, d4z5ry_, d4z5rz_ automated match to d1itfa_ complexed with so4 |
PDB Entry: 4z5r (more details), 3 Å
SCOPe Domain Sequences for d4z5rd_:
Sequence, based on SEQRES records: (download)
>d4z5rd_ a.26.1.3 (D:) Interferon-alpha 2a {Human (Homo sapiens) [TaxId: 9606]} lgsrrtlmllaqmrkislfsclkdrhdfgfpqeefgnqfqkaetipvlhemiqqifnlfs tkdssaawdetlldkfytelyqqlndleacviqgvgvtetplmkedsilavrkyfqritl ylkekkyspcawevvraeimrsfslstn
>d4z5rd_ a.26.1.3 (D:) Interferon-alpha 2a {Human (Homo sapiens) [TaxId: 9606]} lgsrrtlmllaqmrkislfsclkdrhdfgfpqeefgnqfqkaetipvlhemiqqifnlfs tkdssaawdetlldkfytelyqqlndleacviqgvmkedsilavrkyfqritlylkekky spcawevvraeimrsfslstn
Timeline for d4z5rd_:
![]() Domains from other chains: (mouse over for more information) d4z5ra1, d4z5ra2, d4z5rb_, d4z5re_, d4z5rf_, d4z5rg_, d4z5rh_, d4z5ri_, d4z5rj1, d4z5rj2, d4z5rk_, d4z5rl1, d4z5rl2, d4z5rm_, d4z5rn_, d4z5rp1, d4z5rp2, d4z5rq_, d4z5rr1, d4z5rr2, d4z5rs_, d4z5rt1, d4z5rt2, d4z5ru_, d4z5rv1, d4z5rv2, d4z5rw_, d4z5rx_, d4z5ry_, d4z5rz_ |