Lineage for d4z5rd_ (4z5r D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2705447Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 2705448Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 2705784Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins)
    contains an additional helix in one of the crossover connections
  6. 2705785Protein Interferon-alpha 2a [47314] (2 species)
  7. 2705786Species Human (Homo sapiens) [TaxId:9606] [47315] (9 PDB entries)
  8. 2705789Domain d4z5rd_: 4z5r D: [274819]
    Other proteins in same PDB: d4z5ra1, d4z5ra2, d4z5rb_, d4z5rj1, d4z5rj2, d4z5rk_, d4z5rl1, d4z5rl2, d4z5rm_, d4z5rp1, d4z5rp2, d4z5rq_, d4z5rr1, d4z5rr2, d4z5rs_, d4z5rt1, d4z5rt2, d4z5ru_, d4z5rv1, d4z5rv2, d4z5rw_, d4z5ry_, d4z5rz_
    automated match to d1itfa_
    complexed with so4

Details for d4z5rd_

PDB Entry: 4z5r (more details), 3 Å

PDB Description: rontalizumab fab bound to interferon-a2
PDB Compounds: (D:) Interferon alpha-2

SCOPe Domain Sequences for d4z5rd_:

Sequence, based on SEQRES records: (download)

>d4z5rd_ a.26.1.3 (D:) Interferon-alpha 2a {Human (Homo sapiens) [TaxId: 9606]}
lgsrrtlmllaqmrkislfsclkdrhdfgfpqeefgnqfqkaetipvlhemiqqifnlfs
tkdssaawdetlldkfytelyqqlndleacviqgvgvtetplmkedsilavrkyfqritl
ylkekkyspcawevvraeimrsfslstn

Sequence, based on observed residues (ATOM records): (download)

>d4z5rd_ a.26.1.3 (D:) Interferon-alpha 2a {Human (Homo sapiens) [TaxId: 9606]}
lgsrrtlmllaqmrkislfsclkdrhdfgfpqeefgnqfqkaetipvlhemiqqifnlfs
tkdssaawdetlldkfytelyqqlndleacviqgvmkedsilavrkyfqritlylkekky
spcawevvraeimrsfslstn

SCOPe Domain Coordinates for d4z5rd_:

Click to download the PDB-style file with coordinates for d4z5rd_.
(The format of our PDB-style files is described here.)

Timeline for d4z5rd_: