Lineage for d4xmll2 (4xml L:106-210)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2024392Protein automated matches [190374] (14 species)
    not a true protein
  7. 2024406Species Human (Homo sapiens) [TaxId:9606] [187221] (683 PDB entries)
  8. 2025244Domain d4xmll2: 4xml L:106-210 [274812]
    Other proteins in same PDB: d4xmll1
    automated match to d4r4ba2

Details for d4xmll2

PDB Entry: 4xml (more details), 2.68 Å

PDB Description: crystal structure of fab of hiv-1 gp120 v3-specific human monoclonal antibody 2424
PDB Compounds: (L:) Light chain of HIV-1 gp120 V3-specific human monoclonal antibody 2424

SCOPe Domain Sequences for d4xmll2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xmll2 b.1.1.2 (L:106-210) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

SCOPe Domain Coordinates for d4xmll2:

Click to download the PDB-style file with coordinates for d4xmll2.
(The format of our PDB-style files is described here.)

Timeline for d4xmll2: