SCOPe 2.08: Domain d4xmll2: 4xml L:106-210

Lineage for d4xmll2 (4xml L:106-210)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d4xmll2: 4xml L:106-210 [274812]
   Other proteins in same PDB: d4xmlh_, d4xmll1
   automated match to d4r4ba2

Details for d4xmll2

PDB Entry: 4xml, 2.68 Å

PDB Description: crystal structure of fab of hiv-1 gp120 v3-specific human monoclonal antibody 2424

PDB Compounds: (L:) Light chain of HIV-1 gp120 V3-specific human monoclonal antibody 2424

SCOPe Domain Sequences for d4xmll2:

Sequence; same for both SEQRES and ATOM records:

>d4xmll2 b.1.1.2 (L:106-210) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Timeline for d4xmll2:

• d4xmll2 first appeared in SCOPe 2.05
  
• d4xmll2 appears in SCOPe 2.07