![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
![]() | Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) ![]() |
![]() | Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
![]() | Protein automated matches [190151] (166 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [225404] (32 PDB entries) |
![]() | Domain d4wyfb_: 4wyf B: [274805] automated match to d4cxqa_ complexed with 3vx, plp |
PDB Entry: 4wyf (more details), 2.25 Å
SCOPe Domain Sequences for d4wyfb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wyfb_ c.67.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} ltpeqiiavdgahlwhpyssigreavspvvavaahgawltlirdgqpievldamsswwta ihghghpaldqalttqlrvmnhvmfgglthepaarlakllvditpagldtvffsdsgsvs vevaakmalqywrgrglpgkrrlmtwrggyhgdtflamsicdphggmhslwtdvlaaqvf apqvprdydpaysaafeaqlaqhagelaavvvepvvqgaggmrfhdprylhdlrdicrry evllifdeiatgfgrtgalfaadhagvspdimcvgkaltggylslaatlctadvahtisa gaagalmhgptfmanplacavsvasvelllgqdwrtritelaagltagldtaralpavtd vrvcgaigviecdrpvdlavatpaaldrgvwlrpfrnlvyamppyictpaeitqitsamv evarlv
Timeline for d4wyfb_: