SCOPe 2.05: Domain d4wu0b_: 4wu0 B:

Lineage for d4wu0b_ (4wu0 B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families)

5. Family a.102.1.0: automated matches [191318] (1 protein)
   not a true family

6. Protein automated matches [190108] (11 species)
   not a true protein

7. Species Clostridium acetobutylicum [TaxId:272562] [274794] (1 PDB entry)

8. Domain d4wu0b_: 4wu0 B: [274796]
   automated match to d1nc5a_

Details for d4wu0b_

PDB Entry: 4wu0, 1.6 Å

PDB Description: structural analysis of c. acetobutylicum atcc 824 glycoside hydrolase from family 105

PDB Compounds: (B:) Similar to yteR (Bacilus subtilis)

SCOPe Domain Sequences for d4wu0b_:

Sequence; same for both SEQRES and ATOM records:

>d4wu0b_ a.102.1.0 (B:) automated matches {Clostridium acetobutylicum [TaxId: 272562]}
qkysklmadsiiaknitltdhwgyeygltldgiakvyewtkdkkyldfiiktmdtfined
gtingykleeynidhlnngkilitlfketgkekyrkalinlrkqidnhprtkenvfwhkn
iyphqiwldglymgatfyakyvkefgeekefddithqfiiteknlkdnktgllyhaydes
ktepwsnsetglsphfwgramgwyvmaladtievlpknhkdrnalikilnncvtallkvq
dnaskvwyqvldegerkgnyleasgssmivyallkgvrlgylpeslketakeaykgline
filetkdglinlnkicyvaglggkdkrdgsfayyisepivsnepkglgpfllasyeyetl

Timeline for d4wu0b_:

• d4wu0b_ is new in SCOPe 2.05-stable
  
• d4wu0b_ appears in SCOPe 2.06
  
• d4wu0b_ appears in the current release, SCOPe 2.08