Lineage for d4wu0b_ (4wu0 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2722035Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2722036Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2722309Family a.102.1.0: automated matches [191318] (1 protein)
    not a true family
  6. 2722310Protein automated matches [190108] (23 species)
    not a true protein
  7. 2722322Species Clostridium acetobutylicum [TaxId:272562] [274794] (1 PDB entry)
  8. 2722324Domain d4wu0b_: 4wu0 B: [274796]
    automated match to d1nc5a_

Details for d4wu0b_

PDB Entry: 4wu0 (more details), 1.6 Å

PDB Description: structural analysis of c. acetobutylicum atcc 824 glycoside hydrolase from family 105
PDB Compounds: (B:) Similar to yteR (Bacilus subtilis)

SCOPe Domain Sequences for d4wu0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wu0b_ a.102.1.0 (B:) automated matches {Clostridium acetobutylicum [TaxId: 272562]}
qkysklmadsiiaknitltdhwgyeygltldgiakvyewtkdkkyldfiiktmdtfined
gtingykleeynidhlnngkilitlfketgkekyrkalinlrkqidnhprtkenvfwhkn
iyphqiwldglymgatfyakyvkefgeekefddithqfiiteknlkdnktgllyhaydes
ktepwsnsetglsphfwgramgwyvmaladtievlpknhkdrnalikilnncvtallkvq
dnaskvwyqvldegerkgnyleasgssmivyallkgvrlgylpeslketakeaykgline
filetkdglinlnkicyvaglggkdkrdgsfayyisepivsnepkglgpfllasyeyetl

SCOPe Domain Coordinates for d4wu0b_:

Click to download the PDB-style file with coordinates for d4wu0b_.
(The format of our PDB-style files is described here.)

Timeline for d4wu0b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4wu0a_