Lineage for d4twza2 (4twz A:269-332)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2514349Fold d.48: Anti-LPS factor/recA domain [54751] (2 superfamilies)
    alpha-beta(3)-alpha(2); 2 layers, alpha/beta
  4. 2514350Superfamily d.48.1: RecA protein, C-terminal domain [54752] (2 families) (S)
  5. 2514351Family d.48.1.1: RecA protein, C-terminal domain [54753] (1 protein)
  6. 2514352Protein RecA protein, C-terminal domain [54754] (5 species)
  7. 2514355Species Escherichia coli [TaxId:562] [54755] (9 PDB entries)
    Uniprot P0A7G6 P03017
  8. 2514363Domain d4twza2: 4twz A:269-332 [274786]
    Other proteins in same PDB: d4twza1
    automated match to d2reba2
    complexed with mg

Details for d4twza2

PDB Entry: 4twz (more details), 2.8 Å

PDB Description: crystal structure analysis of e coli. reca protein
PDB Compounds: (A:) Protein recA

SCOPe Domain Sequences for d4twza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4twza2 d.48.1.1 (A:269-332) RecA protein, C-terminal domain {Escherichia coli [TaxId: 562]}
nfygelvdlgvkekliekagawysykgekigqgkanatawlkdnpetakeiekkvrelll
snpn

SCOPe Domain Coordinates for d4twza2:

Click to download the PDB-style file with coordinates for d4twza2.
(The format of our PDB-style files is described here.)

Timeline for d4twza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4twza1