SCOPe 2.06: Domain d4twza1: 4twz A:6-268

Lineage for d4twza1 (4twz A:6-268)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (21 proteins)
   core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest

6. Protein RecA protein, ATPase-domain [52671] (6 species)
   C-terminal domain is alpha+beta

7. Species Escherichia coli [TaxId:83333] [274784] (1 PDB entry)

8. Domain d4twza1: 4twz A:6-268 [274785]
   Other proteins in same PDB: d4twza2
   automated match to d2reba1
   complexed with mg

Details for d4twza1

PDB Entry: 4twz, 2.8 Å

PDB Description: crystal structure analysis of e coli. reca protein

PDB Compounds: (A:) Protein recA

SCOPe Domain Sequences for d4twza1:

Sequence; same for both SEQRES and ATOM records:

>d4twza1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 83333]}
kqkalaaalgqiekqfgkgsimrlgedrsmdvetistgslsldialgagglpmgriveiy
gpessgkttltlqviaaaqregktcafidaehaldpiyarklgvdidnllcsqpdtgeqa
leicdalarsgavdvivvdsvaaltpkaeiegeigdshmglaarmmsqamrklagnlkqs
ntllifinqirmkigvmfgnpetttggnalkfyasvrldirrigavkegenvvgsetrvk
vvknkiaapfkqaefqilygegi

Timeline for d4twza1:

• d4twza1 first appeared in SCOPe 2.05
  
• d4twza1 appears in SCOPe 2.07
  
• d4twza1 appears in the current release, SCOPe 2.08