Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.166: ADP-ribosylation [56398] (1 superfamily) unusual fold |
Superfamily d.166.1: ADP-ribosylation [56399] (8 families) |
Family d.166.1.2: Poly(ADP-ribose) polymerase, C-terminal domain [56416] (2 proteins) automatically mapped to Pfam PF00644 |
Protein automated matches [227023] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225783] (6 PDB entries) |
Domain d4tvjb2: 4tvj B:365-579 [274783] Other proteins in same PDB: d4tvja1, d4tvja3, d4tvjb1, d4tvjb3 automated match to d3kjda2 complexed with 09l, gol |
PDB Entry: 4tvj (more details), 2.1 Å
SCOPe Domain Sequences for d4tvjb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4tvjb2 d.166.1.2 (B:365-579) automated matches {Human (Homo sapiens) [TaxId: 9606]} lhcalrpldhesyefkvisqylqsthapthsdytmtlldlfevekdgekeafredlhnrm llwhgsrmsnwvgilshglriahpeapitgymfgkgiyfadmssksanycfasrlkntgl lllsevalgqcnelleanpkaegllqgkhstkglgkmapssahfvtlngstvplgpasdt gilnpdgytlnyneyivynpnqvrmryllkvqfnf
Timeline for d4tvjb2: