Lineage for d4tvjb1 (4tvj B:235-364)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712204Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily)
    core: 4 helices: bundle; unusual topology
  4. 2712205Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families) (S)
    duplication: consists of 2 helix-loop-helix structural repeats
    automatically mapped to Pfam PF02877
  5. 2712230Family a.41.1.0: automated matches [227223] (1 protein)
    not a true family
  6. 2712231Protein automated matches [226964] (2 species)
    not a true protein
  7. 2712235Species Human (Homo sapiens) [TaxId:9606] [225405] (61 PDB entries)
  8. 2712291Domain d4tvjb1: 4tvj B:235-364 [274782]
    Other proteins in same PDB: d4tvja2, d4tvja3, d4tvjb2, d4tvjb3
    automated match to d3kcza1
    complexed with 09l, gol

Details for d4tvjb1

PDB Entry: 4tvj (more details), 2.1 Å

PDB Description: human artd2 (parp2) - catalytic domain in complex with olaparib
PDB Compounds: (B:) Poly [ADP-ribose] polymerase 2

SCOPe Domain Sequences for d4tvjb1:

Sequence, based on SEQRES records: (download)

>d4tvjb1 a.41.1.0 (B:235-364) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlrvqeliklicnvqameemmmemkyntkkaplgkltvaqikagyqslkkiedciragqh
gralmeacnefytriphdfglrtpplirtqkelsekiqllealgdieiaiklvktelqsp
ehpldqhyrn

Sequence, based on observed residues (ATOM records): (download)

>d4tvjb1 a.41.1.0 (B:235-364) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlrvqeliklicnvqameemmmemkyntkkaplgkltvaqikagyqslkkiedciragqh
gralmeacnefytriphdfglrtpplirtqkelsekiqllealgdieiaiklvktspehp
ldqhyrn

SCOPe Domain Coordinates for d4tvjb1:

Click to download the PDB-style file with coordinates for d4tvjb1.
(The format of our PDB-style files is described here.)

Timeline for d4tvjb1: