| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily) core: 4 helices: bundle; unusual topology |
Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families) ![]() duplication: consists of 2 helix-loop-helix structural repeats automatically mapped to Pfam PF02877 |
| Family a.41.1.0: automated matches [227223] (1 protein) not a true family |
| Protein automated matches [226964] (2 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [225405] (62 PDB entries) |
| Domain d4tvja1: 4tvj A:235-364 [274780] Other proteins in same PDB: d4tvja2, d4tvja3, d4tvjb2, d4tvjb3 automated match to d3kcza1 complexed with 09l, gol |
PDB Entry: 4tvj (more details), 2.1 Å
SCOPe Domain Sequences for d4tvja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4tvja1 a.41.1.0 (A:235-364) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlrvqeliklicnvqameemmmemkyntkkaplgkltvaqikagyqslkkiedciragqh
gralmeacnefytriphdfglrtpplirtqkelsekiqllealgdieiaiklvktelqsp
ehpldqhyrn
Timeline for d4tvja1: