SCOP 1.69: Domain d1awvc_: 1awv C:

Lineage for d1awvc_ (1awv C:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (2 families)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (3 proteins)

6. Protein Cyclophilin (eukaryotic) [50893] (9 species)

7. Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (42 PDB entries)

8. Domain d1awvc_: 1awv C: [27477]

Details for d1awvc_

PDB Entry: 1awv, 2.34 Å

PDB Description: cypa complexed with hvgpia

SCOP Domain Sequences for d1awvc_:

Sequence; same for both SEQRES and ATOM records:

>d1awvc_ b.62.1.1 (C:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A}
vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
cqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktew
ldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

Timeline for d1awvc_:

• d1awvc_ first appeared (with stable ids) in SCOP 1.55
  
• d1awvc_ appears in SCOP 1.67
  
• d1awvc_ appears in SCOP 1.71
  
• d1awvc_ appears in the current release, SCOPe 2.08