Lineage for d1awvc_ (1awv C:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 232982Fold b.62: Cyclophilin (peptidylprolyl isomerase) [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 232983Superfamily b.62.1: Cyclophilin (peptidylprolyl isomerase) [50891] (1 family) (S)
  5. 232984Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (3 proteins)
  6. 232990Protein Cyclophilin (eukaryotic) [50893] (8 species)
  7. 232999Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (35 PDB entries)
  8. 233060Domain d1awvc_: 1awv C: [27477]

Details for d1awvc_

PDB Entry: 1awv (more details), 2.34 Å

PDB Description: cypa complexed with hvgpia

SCOP Domain Sequences for d1awvc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1awvc_ b.62.1.1 (C:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A}
vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
cqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktew
ldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

SCOP Domain Coordinates for d1awvc_:

Click to download the PDB-style file with coordinates for d1awvc_.
(The format of our PDB-style files is described here.)

Timeline for d1awvc_: