Lineage for d4tscl2 (4tsc L:108-209)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2352435Protein automated matches [190374] (14 species)
    not a true protein
  7. 2352460Species Human (Homo sapiens) [TaxId:9606] [187221] (808 PDB entries)
  8. 2352788Domain d4tscl2: 4tsc L:108-209 [274761]
    Other proteins in same PDB: d4tsca_, d4tscl1
    automated match to d2fb4l2

Details for d4tscl2

PDB Entry: 4tsc (more details), 1.92 Å

PDB Description: structure of a lysozyme antibody complex
PDB Compounds: (L:) Fab light chain

SCOPe Domain Sequences for d4tscl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tscl2 b.1.1.2 (L:108-209) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapt

SCOPe Domain Coordinates for d4tscl2:

Click to download the PDB-style file with coordinates for d4tscl2.
(The format of our PDB-style files is described here.)

Timeline for d4tscl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4tscl1
View in 3D
Domains from other chains:
(mouse over for more information)
d4tsca_