Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins) |
Protein Purine nucleoside phosphorylase, PNP [53169] (14 species) |
Species Escherichia coli [TaxId:562] [53172] (30 PDB entries) |
Domain d4ttjb_: 4ttj B: [274756] automated match to d4rj2a_ complexed with fmc, po4, so4; mutant |
PDB Entry: 4ttj (more details), 1.87 Å
SCOPe Domain Sequences for d4ttjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ttjb_ c.56.2.1 (B:) Purine nucleoside phosphorylase, PNP {Escherichia coli [TaxId: 562]} atphinaemgdfadvvlmpgdplrakyiaetfledarevnnvrgmlgftgtykgrkisvm ghgmgipscsiytkelitdfgvkkiirvgscgavlphvklrdvvigmgactdskvnrirf kdhdfaaiadfdmvrnavdaakalgidarvgnlfsadlfyspdgemfdvmekygilgvem eaagiygvaaefgakaltictvsahirtheqttaaeaqttfndmikialesvllgdk
Timeline for d4ttjb_: