Lineage for d4ts9b_ (4ts9 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2495627Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2495644Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2495645Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 2495769Protein Purine nucleoside phosphorylase, PNP [53169] (14 species)
  7. 2495830Species Escherichia coli [TaxId:562] [53172] (28 PDB entries)
  8. 2495874Domain d4ts9b_: 4ts9 B: [274753]
    automated match to d4rj2a_
    complexed with fmc, po4

Details for d4ts9b_

PDB Entry: 4ts9 (more details), 1.77 Å

PDB Description: crystal structure of wild type e. coli purine nucleoside phosphorylase with 6 fmc molecules
PDB Compounds: (B:) Purine nucleoside phosphorylase deoD-type

SCOPe Domain Sequences for d4ts9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ts9b_ c.56.2.1 (B:) Purine nucleoside phosphorylase, PNP {Escherichia coli [TaxId: 562]}
atphinaemgdfadvvlmpgdplrakyiaetfledarevnnvrgmlgftgtykgrkisvm
ghgmgipscsiytkelitdfgvkkiirvascgavlphvklrdvvigmgactdskvnrirf
kdhdfaaiadfdmvrnavdaakalgidarvgnlfsadlfyspdgemfdvmekygilgvem
eaagiygvaaefgakaltictvsdhirtheqttaaerqttfndmikialesvllgdk

SCOPe Domain Coordinates for d4ts9b_:

Click to download the PDB-style file with coordinates for d4ts9b_.
(The format of our PDB-style files is described here.)

Timeline for d4ts9b_: