Lineage for d2n2ka_ (2n2k A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2501111Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2501112Family d.15.1.1: Ubiquitin-related [54237] (39 protein domains)
    Pfam PF00240
  6. 2501389Protein Ubiquitin [54238] (8 species)
  7. 2501491Species Human (Homo sapiens) [TaxId:9606] [54239] (217 PDB entries)
    Uniprot P62988
    identical sequence in many other species
  8. 2501924Domain d2n2ka_: 2n2k A: [274740]
    automated match to d4k1rb_
    complexed with mtn

Details for d2n2ka_

PDB Entry: 2n2k (more details)

PDB Description: ensemble structure of the closed state of lys63-linked diubiquitin in the absence of a ligand
PDB Compounds: (A:) Ubiquitin

SCOPe Domain Sequences for d2n2ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2n2ka_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]}
mqifvktltgktitlevepsdtiecvkakiqdkegippdqqrlifagcqledgrtlsdyn
iqkestlhlvlrlrgg

SCOPe Domain Coordinates for d2n2ka_:

Click to download the PDB-style file with coordinates for d2n2ka_.
(The format of our PDB-style files is described here.)

Timeline for d2n2ka_: