Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
Protein automated matches [190131] (59 species) not a true protein |
Species Brucella abortus [TaxId:235] [274729] (2 PDB entries) |
Domain d4d6xd_: 4d6x D: [274734] automated match to d1zy2b_ complexed with imd |
PDB Entry: 4d6x (more details), 2.11 Å
SCOPe Domain Sequences for d4d6xd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4d6xd_ c.23.1.0 (D:) automated matches {Brucella abortus [TaxId: 235]} dilvvddevdirdlvagilsdeghetrtafdadsalaaindraprlvfldiwlqgsrldg lalldeikkqhpelpvvmisghgnietavsairrgaydfiekpfkadrlilvaeralet
Timeline for d4d6xd_: