Lineage for d4d6ya_ (4d6y A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2114716Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2115095Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2115096Protein automated matches [190131] (71 species)
    not a true protein
  7. 2115161Species Brucella abortus [TaxId:235] [274729] (2 PDB entries)
  8. 2115162Domain d4d6ya_: 4d6y A: [274733]
    automated match to d1zy2b_
    complexed with bef, mg

Details for d4d6ya_

PDB Entry: 4d6y (more details), 1.7 Å

PDB Description: crystal structure of the receiver domain of ntrx from brucella abortus in complex with beryllofluoride and magnesium
PDB Compounds: (A:) bacterial regulatory, fis family protein

SCOPe Domain Sequences for d4d6ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4d6ya_ c.23.1.0 (A:) automated matches {Brucella abortus [TaxId: 235]}
dilvvddevdirdlvagilsdeghetrtafdadsalaaindraprlvfldiwlqgsrldg
lalldeikkqhpelpvvmisghgnietavsairrgaydfiekpfkadrlilvaeralets
k

SCOPe Domain Coordinates for d4d6ya_:

Click to download the PDB-style file with coordinates for d4d6ya_.
(The format of our PDB-style files is described here.)

Timeline for d4d6ya_: